AS2TS service is designed to facilitate the modeling of tertiary structure (3D model) for a given sequence of amino-acids. Be aware that not for all proteins a correct 3D model can be produced using the current version of the system. Please check HELP for more information about AS2TS service.
First enter your email address in the box below. (Optional) E-mail Be sure that your email address is correct. You will be notified when the results from AS2TS modeling are completed. Bear in mind that if you enter an incorrect email address there is no way the server can contact you!
If you have already sequence-structure alignment generated, you can use AL2TS server to build 3D model.
For AS2TS server the sequence of amino-acids should be introduced in FASTA format (see example):
>Protein_name (FASTA format) MRFKLSVIIFVLVSASALATPSFNVGFSPSHTALENVLSVVNNAQSSLDVEAYTFTSK QISTAIVSAQKRGVNVRVVADAKANRLNYSAIHYLAQQHVPVRLNNNYSIHHNKVMIA DGDTIQTGSMNYTTNGDTHNAENVLVIRGAPEIAGKYQVEFNRLWA
Paste or type your protein sequence (FASTA format) into the box below.
Selection of the method for sequence alignment search: Pairwise sequence alignment search: Smith-Waterman FASTA BLAST or Multiple sequence alignment search: PSI-BLAST, Number of iterations: ( 2 <= n <= 9 )
Mutation matrix: BL45 P250 BL50 BL62 BL80 PA70 PA30
Local library for the sequence alignment search: (PDB, nr, Uniref_100, Uniref_90, Uniref_50, ...)
DIG-SC (deletion/insertion/gap and side-chain) building procedure applied to the top N models: ( max = 10 ) Note: DIG-SC are time-consuming calculations. For quick (main-chain only) calculations select: 0